DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS3 and RGD1560831

DIOPT Version :9

Sequence 1:NP_001287481.1 Gene:RpS3 / 42761 FlyBaseID:FBgn0002622 Length:246 Species:Drosophila melanogaster
Sequence 2:XP_038962267.1 Gene:RGD1560831 / 499803 RGDID:1560831 Length:243 Species:Rattus norvegicus


Alignment Length:235 Identity:186/235 - (79%)
Similarity:205/235 - (87%) Gaps:8/235 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIREL 71
            ||||||||:||||||||||||||||||||||.|||||||:||||||:.|:||.||||||||||||
  Rat     5 ISKKRKFVADGIFKAELNEFLTRELAEDGYSRVEVRVTPTRTEIIILGTRTQNVLGEKGRRIREL 69

  Fly    72 TAMVQKRFNFETGRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGC 136
            ||:|||:|.|..|.:||||||||..|||||||||||.|||.||||||||||||||:||||||:||
  Rat    70 TAVVQKQFVFPEGSVELYAEKVATGGLCAIAQAESLCYKLLGGLAVRRACYGVLRFIMESGAEGC 134

  Fly   137 EVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIG 201
            |||||||||||||||:|||||||||||||.|.||:||.|||||||||||||||:|||:||..|||
  Rat   135 EVVVSGKLRGQRAKSVKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPSGKIG 199

  Fly   202 PKKPLPDNVSVVEPKEEKIYETPETEYK--------IPPP 233
            |||||||:||:||||:|.:..||.:|.|        :|.|
  Rat   200 PKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPHAMPQP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS3NP_001287481.1 PTZ00084 6..222 CDD:240260 180/214 (84%)
RGD1560831XP_038962267.1 PTZ00084 4..216 CDD:240260 179/210 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349239
Domainoid 1 1.000 155 1.000 Domainoid score I4134
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 382 1.000 Inparanoid score I1979
OMA 1 1.010 - - QHG60603
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001904
OrthoInspector 1 1.000 - - otm46202
orthoMCL 1 0.900 - - OOG6_100514
Panther 1 1.100 - - O PTHR11760
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2144
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.