DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS3 and Rps3

DIOPT Version :9

Sequence 1:NP_001287481.1 Gene:RpS3 / 42761 FlyBaseID:FBgn0002622 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001009239.1 Gene:Rps3 / 140654 RGDID:619888 Length:243 Species:Rattus norvegicus


Alignment Length:230 Identity:193/230 - (83%)
Similarity:208/230 - (90%) Gaps:0/230 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIREL 71
            ||||||||:||||||||||||||||||||||||||||||:||||||:||:||.||||||||||||
  Rat     5 ISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIREL 69

  Fly    72 TAMVQKRFNFETGRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGC 136
            ||:|||||.|..|.:||||||||.||||||||||||||||.||||||||||||||:|||||||||
  Rat    70 TAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGC 134

  Fly   137 EVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIG 201
            |||||||||||||||||||||||||||||.|.||:||.|||||||||||||||:|||:||..|||
  Rat   135 EVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPSGKIG 199

  Fly   202 PKKPLPDNVSVVEPKEEKIYETPETEYKIPPPSKP 236
            |||||||:||:||||:|.:..||.:|.|...|..|
  Rat   200 PKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS3NP_001287481.1 PTZ00084 6..222 CDD:240260 187/214 (87%)
Rps3NP_001009239.1 PTZ00084 4..216 CDD:240260 186/210 (89%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..243 20/35 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349241
Domainoid 1 1.000 155 1.000 Domainoid score I4134
eggNOG 1 0.900 - - E1_COG0092
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H779
Inparanoid 1 1.050 382 1.000 Inparanoid score I1979
OMA 1 1.010 - - QHG60603
OrthoDB 1 1.010 - - D1135751at2759
OrthoFinder 1 1.000 - - FOG0001904
OrthoInspector 1 1.000 - - otm46202
orthoMCL 1 0.900 - - OOG6_100514
Panther 1 1.100 - - LDO PTHR11760
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2144
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.