DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynCF6 and si:ch211-140m22.7

DIOPT Version :9

Sequence 1:NP_001247264.1 Gene:ATPsynCF6 / 42759 FlyBaseID:FBgn0016119 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_009302913.1 Gene:si:ch211-140m22.7 / 570370 ZFINID:ZDB-GENE-070912-73 Length:484 Species:Danio rerio


Alignment Length:93 Identity:32/93 - (34%)
Similarity:50/93 - (53%) Gaps:18/93 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 APALNKAS--------------DPIQQLFLDKVREY-KQKSAGGKLVDSNPDIERELKTELDRVA 74
            ||.:..|:              ||||:||||.:|.| .|..|.|.|||:.|:.::.|..|:.::.
Zfish   393 APVITDAAEAPTEVVETPEAGLDPIQKLFLDSIRAYSSQTGAAGGLVDAGPEYQKALAEEIAKLQ 457

  Fly    75 KQFGSDGKTDMLKFPEFQFPDVKVDPIT 102
            :.:|..   |:..||||:||:.|.|.::
Zfish   458 RLYGGG---DLSSFPEFKFPEPKFDDVS 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCF6NP_001247264.1 ATP-synt_F6 11..94 CDD:283226 28/83 (34%)
si:ch211-140m22.7XP_009302913.1 ATP-synt_F6 <414..474 CDD:283226 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580644
Domainoid 1 1.000 64 1.000 Domainoid score I10118
eggNOG 1 0.900 - - E1_KOG4634
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1559269at2759
OrthoFinder 1 1.000 - - FOG0004897
OrthoInspector 1 1.000 - - mtm6479
orthoMCL 1 0.900 - - OOG6_107026
Panther 1 1.100 - - O PTHR12441
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.710

Return to query results.
Submit another query.