DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynCF6 and atp5pf

DIOPT Version :9

Sequence 1:NP_001247264.1 Gene:ATPsynCF6 / 42759 FlyBaseID:FBgn0016119 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001017042.1 Gene:atp5pf / 549796 XenbaseID:XB-GENE-987263 Length:107 Species:Xenopus tropicalis


Alignment Length:111 Identity:43/111 - (38%)
Similarity:66/111 - (59%) Gaps:12/111 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSQSLLSGMRVLRTEA----RRNFGIVAPALNKAS--DPIQQLFLDKVREYKQKS--AGGKLVD 57
            |:.|.|.....|.||..    |||.|:.|.|.|||.  ||:|:||:||:|||..||  :||. ||
 Frog     1 MILQRLFRFSSVFRTSVSVHLRRNIGLTAIAFNKAKELDPVQRLFVDKIREYNTKSQKSGGP-VD 64

  Fly    58 SNPDIERELKTELDRVAKQFGSDGKTDMLKFPEFQFPDVKVDPITQ 103
            :.|:.:::|..::.::.:.:|..   |:.|||||:|.:.|.:..|:
 Frog    65 AGPEYQKDLTEDVTKLQRLYGGG---DLAKFPEFKFEEPKFEESTK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCF6NP_001247264.1 ATP-synt_F6 11..94 CDD:283226 37/90 (41%)
atp5pfNP_001017042.1 ATP-synt_F6 1..98 CDD:368479 40/100 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9786
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5143
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1559269at2759
OrthoFinder 1 1.000 - - FOG0004897
OrthoInspector 1 1.000 - - otm48053
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4477
SonicParanoid 1 1.000 - - X4582
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.