DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynCF6 and ATPsynCF6L

DIOPT Version :9

Sequence 1:NP_001247264.1 Gene:ATPsynCF6 / 42759 FlyBaseID:FBgn0016119 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_647942.1 Gene:ATPsynCF6L / 38592 FlyBaseID:FBgn0035585 Length:147 Species:Drosophila melanogaster


Alignment Length:78 Identity:41/78 - (52%)
Similarity:53/78 - (67%) Gaps:4/78 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NKAS----DPIQQLFLDKVREYKQKSAGGKLVDSNPDIERELKTELDRVAKQFGSDGKTDMLKFP 89
            |.||    |||.|:||||||||:.||..||.||..|:.|.|||...:|:|.|:|.....|||:||
  Fly    18 NTASLRYKDPIYQIFLDKVREYRLKSPKGKPVDPGPEFEAELKEVTERLALQYGGGEGVDMLEFP 82

  Fly    90 EFQFPDVKVDPIT 102
            :|:.||:.:|||:
  Fly    83 KFKLPDIDIDPIS 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCF6NP_001247264.1 ATP-synt_F6 11..94 CDD:283226 36/68 (53%)
ATPsynCF6LNP_647942.1 ATP-synt_F6 9..87 CDD:283226 36/68 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449093
Domainoid 1 1.000 64 1.000 Domainoid score I10118
eggNOG 1 0.900 - - E1_KOG4634
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6548
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1559269at2759
OrthoFinder 1 1.000 - - FOG0004897
OrthoInspector 1 1.000 - - mtm6479
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12441
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4477
SonicParanoid 1 1.000 - - X4582
1110.830

Return to query results.
Submit another query.