powered by:
Protein Alignment ATPsynCF6 and atp-4
DIOPT Version :9
Sequence 1: | NP_001247264.1 |
Gene: | ATPsynCF6 / 42759 |
FlyBaseID: | FBgn0016119 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379991.1 |
Gene: | atp-4 / 179025 |
WormBaseID: | WBGene00020275 |
Length: | 129 |
Species: | Caenorhabditis elegans |
Alignment Length: | 72 |
Identity: | 25/72 - (34%) |
Similarity: | 40/72 - (55%) |
Gaps: | 3/72 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 DPIQQLFLDKVREYKQKSAGGKLVDSNPDIERELKTELDRVAKQFGSDGKTDMLKFPEFQFPDVK 97
|.|||.|:.|:||..:.: |.|.:|:|.:::.|:.||:|:|.:|.......:.|.|. .|...|
Worm 20 DLIQQTFVTKIREIAKNA--GNLANSDPAVKKALQEELNRLATKFQLANADVVSKLPT-NFEAAK 81
Fly 98 VDPITQA 104
||...|:
Worm 82 VDSAVQS 88
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4634 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
40 |
1.000 |
Inparanoid score |
I4157 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004897 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_107026 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR12441 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.860 |
|
Return to query results.
Submit another query.