DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynCF6 and atp-4

DIOPT Version :9

Sequence 1:NP_001247264.1 Gene:ATPsynCF6 / 42759 FlyBaseID:FBgn0016119 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001379991.1 Gene:atp-4 / 179025 WormBaseID:WBGene00020275 Length:129 Species:Caenorhabditis elegans


Alignment Length:72 Identity:25/72 - (34%)
Similarity:40/72 - (55%) Gaps:3/72 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DPIQQLFLDKVREYKQKSAGGKLVDSNPDIERELKTELDRVAKQFGSDGKTDMLKFPEFQFPDVK 97
            |.|||.|:.|:||..:.:  |.|.:|:|.:::.|:.||:|:|.:|.......:.|.|. .|...|
 Worm    20 DLIQQTFVTKIREIAKNA--GNLANSDPAVKKALQEELNRLATKFQLANADVVSKLPT-NFEAAK 81

  Fly    98 VDPITQA 104
            ||...|:
 Worm    82 VDSAVQS 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCF6NP_001247264.1 ATP-synt_F6 11..94 CDD:283226 20/60 (33%)
atp-4NP_001379991.1 ATP-synt_F6 3..62 CDD:398910 17/43 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4634
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 40 1.000 Inparanoid score I4157
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004897
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107026
Panther 1 1.100 - - LDO PTHR12441
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.