DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynCF6 and Atp5j

DIOPT Version :9

Sequence 1:NP_001247264.1 Gene:ATPsynCF6 / 42759 FlyBaseID:FBgn0016119 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001289142.1 Gene:Atp5j / 11957 MGIID:107777 Length:108 Species:Mus musculus


Alignment Length:111 Identity:44/111 - (39%)
Similarity:65/111 - (58%) Gaps:9/111 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSQSLLSGMRVLRT----EARRNFGIVAPALNKASDPIQQLFLDKVREYKQK-SAGGKLVDSNP 60
            |:.|.:.....|||:    ..:||.|:.|.|.||..||:|:||:||:||||.| .|.|..||..|
Mouse     1 MVLQRIFRLSSVLRSAVSVHLKRNIGVTAVAFNKELDPVQKLFVDKIREYKSKRQASGGPVDIGP 65

  Fly    61 DIERELKTELDRVAKQFGSDGKTDMLKFPEFQFPDVKVDPITQAPQ 106
            :.:::|..||.::.:.:   ||.:|..||.|:|.|.|.:.|.: ||
Mouse    66 EYQQDLDRELYKLKQMY---GKGEMDTFPTFKFDDPKFEVIDK-PQ 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCF6NP_001247264.1 ATP-synt_F6 11..94 CDD:283226 36/87 (41%)
Atp5jNP_001289142.1 ATP-synt_F6 1..95 CDD:398910 38/96 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837091
Domainoid 1 1.000 68 1.000 Domainoid score I9693
eggNOG 1 0.900 - - E1_KOG4634
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5299
Isobase 1 0.950 - 0 Normalized mean entropy S6548
OMA 1 1.010 - - QHG48138
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004897
OrthoInspector 1 1.000 - - otm42928
orthoMCL 1 0.900 - - OOG6_107026
Panther 1 1.100 - - LDO PTHR12441
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4477
SonicParanoid 1 1.000 - - X4582
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.740

Return to query results.
Submit another query.