DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnt and erfl3

DIOPT Version :10

Sequence 1:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:XP_694263.4 Gene:erfl3 / 565909 ZFINID:ZDB-GENE-090529-4 Length:668 Species:Danio rerio


Alignment Length:84 Identity:52/84 - (61%)
Similarity:62/84 - (73%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   606 GSGPIQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRY 670
            ||..||||.|:||||..:.....|:|.||..||.:.|||||||.||.||.||:|||:||||.|||
Zfish    23 GSRQIQLWHFILELLRKEEYHDVIAWQGDYGEFVIKDPDEVARLWGARKCKPQMNYDKLSRALRY 87

  Fly   671 YYDKNIIHKTAGKRYVYRF 689
            ||:|.|:|||.|||:.|:|
Zfish    88 YYNKRILHKTKGKRFTYKF 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 50/81 (62%)
erfl3XP_694263.4 ETS 26..111 CDD:197710 50/81 (62%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.