DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnt and Elf4

DIOPT Version :10

Sequence 1:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_062654.2 Gene:Elf4 / 56501 MGIID:1928377 Length:655 Species:Mus musculus


Alignment Length:109 Identity:49/109 - (44%)
Similarity:63/109 - (57%) Gaps:11/109 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   606 GSG-PIQLWQFLLELLLDK-TCQSFISWT-GDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRG 667
            |.| .|.||:|||.||.|: ||..:|.|| .:...|||.|...|::.||.:||||.||||.:.|.
Mouse   203 GKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKLWGKQKNKPDMNYETMGRA 267

  Fly   668 LRYYYDKNIIHKTAGKRYVYRF--------VCDLQNLVGHTPEE 703
            |||||.:.|:.|..|:|.||:|        |.|.:.....|||:
Mouse   268 LRYYYQRGILAKVEGQRLVYQFKEMPKDLVVIDDEEESPETPED 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 43/93 (46%)
Elf4NP_062654.2 Elf-1_N 2..103 CDD:463529
RUNX1-binding. /evidence=ECO:0000250|UniProtKB:Q99607 86..205 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..202
ETS 207..289 CDD:197710 41/81 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..362 3/11 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 493..512
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.