DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnt and elf2b

DIOPT Version :9

Sequence 1:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:XP_005159885.1 Gene:elf2b / 387534 ZFINID:ZDB-GENE-031215-1 Length:607 Species:Danio rerio


Alignment Length:113 Identity:49/113 - (43%)
Similarity:64/113 - (56%) Gaps:10/113 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   606 GSGPIQLWQFLLELLLDK-TCQSFISWT-GDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGL 668
            |.|...||:|||:||.|| ||..:|.|| .:...|||.|...|::.||..||||.||||.:.|.|
Zfish   215 GKGSTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRAL 279

  Fly   669 RYYYDKNIIHKTAGKRYVYRFVCDLQNLVGHTPEELVAKYDLKIEKKD 716
            ||||.:.|:.|..|:|.||:|        ...|:::|...|.|.:..|
Zfish   280 RYYYQRGILAKVEGQRLVYQF--------KEMPKDIVVIDDDKCDPGD 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 42/85 (49%)
elf2bXP_005159885.1 Elf-1_N 4..121 CDD:289109
Ets 221..300 CDD:278602 41/78 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.