DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnt and edl

DIOPT Version :10

Sequence 1:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_523786.2 Gene:edl / 37149 FlyBaseID:FBgn0023214 Length:177 Species:Drosophila melanogaster


Alignment Length:53 Identity:18/53 - (33%)
Similarity:27/53 - (50%) Gaps:1/53 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 DPREWTEEHVIYWL-NWAKNEFSLVSMNLDPFYKMKGRAMVDLGKEKFLAITP 232
            |||:||...|..|| |.|.:|...|:..|...:.|.|:|:..:..:.:|...|
  Fly   103 DPRDWTRADVWKWLINMAVSEGLEVTAELPQKFPMNGKALCLMSLDMYLCRVP 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879 18/53 (34%)
ETS 609..693 CDD:197710
edlNP_523786.2 SAM_PNT-Mae 103..170 CDD:176086 18/53 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.