DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnt and Elk3

DIOPT Version :10

Sequence 1:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001102213.1 Gene:Elk3 / 362871 RGDID:1307764 Length:408 Species:Rattus norvegicus


Alignment Length:109 Identity:55/109 - (50%)
Similarity:73/109 - (66%) Gaps:4/109 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   610 IQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDK 674
            |.||||||.||||:..:..|.||.:..||||...:|||:.||:||||..|||:||||.|||||||
  Rat     5 ITLWQFLLHLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLSRALRYYYDK 69

  Fly   675 NIIHKTAGKRYVYRFVC--DLQNLVGHTPEELVAKYDLKIEKKD 716
            |||.|..|:::||:||.  |:..:..|..|  :::..|.::..|
  Rat    70 NIIKKVIGQKFVYKFVSFPDILKMDPHAVE--ISRESLLLQDSD 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 50/84 (60%)
Elk3NP_001102213.1 ETS 5..89 CDD:197710 50/83 (60%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.