DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnt and Elf2

DIOPT Version :9

Sequence 1:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001029081.1 Gene:Elf2 / 361944 RGDID:1310585 Length:591 Species:Rattus norvegicus


Alignment Length:192 Identity:67/192 - (34%)
Similarity:85/192 - (44%) Gaps:52/192 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   547 EFTPYDAQSFQSMGPQPTAMDQWGAAHAHQ---------HPAAYMSTLGLDKGLLG--------- 593
            |..|.||      .|.||:.|      :|:         .|....|.:......||         
  Rat   152 ESEPMDA------SPIPTSPD------SHEPMKKKKVGRKPKTQQSPVSNGSPELGVKKKAREGK 204

  Fly   594 GYTTQGGVPCFTGSGPIQLWQFLLELLLDK-TCQSFISWT-GDGWEFKLTDPDEVARRWGIRKNK 656
            |.||             .||:|||:||.|| ||..:|.|| .:...|||.|...|::.||..|||
  Rat   205 GNTT-------------YLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNK 256

  Fly   657 PKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQNLV------GHT-PEELVAKYDLK 711
            |.||||.:.|.|||||.:.|:.|..|:|.||:|....:|:|      ..| ||:|.|..|.|
  Rat   257 PDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKDMPKNIVVIDDDKSETCPEDLAAAADDK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 42/85 (49%)
Elf2NP_001029081.1 Elf-1_N 3..108 CDD:403506
Ets 209..289 CDD:395126 41/79 (52%)
Herpes_BLLF1 <349..>528 CDD:282904
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.