DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnt and Etv2

DIOPT Version :9

Sequence 1:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:XP_038949886.1 Gene:Etv2 / 361544 RGDID:1310603 Length:368 Species:Rattus norvegicus


Alignment Length:285 Identity:102/285 - (35%)
Similarity:128/285 - (44%) Gaps:76/285 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 PGTQNGNIGGYGGGSNSQNDPTDLSSYGLPAHL---AAYGGGS---GSGPTGGR--SSGGGGD-E 486
            |||......|: .|:..||..|  |:.|:|:..   |.:...|   .:||.|..  .||.||: :
  Rat   141 PGTSPSPFVGF-EGATGQNTAT--SAGGVPSWSHPPATWSTASWDCSAGPNGSTYWDSGLGGEAQ 202

  Fly   487 SDYHSTISAQDHQSQQSSGGNGSGGASGGSTGNSNGYLDSSSEFYGSYAGRNRFHDGYPPEFTPY 551
            :||            :.|.| ||.|:...:|.|| |..:.|..|.|...          |.|...
  Rat   203 ADY------------KMSWG-GSAGSDYTTTWNS-GLQNCSIPFEGHQI----------PAFATP 243

  Fly   552 DAQSFQSMGPQPTAMDQWGAAHAHQHPAAYMSTLGLDKGLLGGYTTQGGVPCFTGSGPIQLWQFL 616
            ...|.||                             |:..|..|:..      ...|||||||||
  Rat   244 SKSSQQS-----------------------------DRATLTPYSKT------NHRGPIQLWQFL 273

  Fly   617 LELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDKNIIHKTA 681
            ||||.|....|.|.|||:..||:|.||.||||.||.||.||.||||||||||||||.::|:.|:.
  Rat   274 LELLHDGARSSCIRWTGNNREFQLCDPKEVARLWGERKRKPGMNYEKLSRGLRYYYRRDIVLKSG 338

  Fly   682 GKRYVYRF-----VCDLQNLVGHTP 701
            |::|.|||     |...|:.:||.|
  Rat   339 GRKYTYRFGGRVPVLACQDDMGHLP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 55/88 (63%)
Etv2XP_038949886.1 ETS 266..348 CDD:197710 54/81 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11849
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.