DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnt and Elk4

DIOPT Version :9

Sequence 1:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:XP_008767689.1 Gene:Elk4 / 304786 RGDID:1310504 Length:437 Species:Rattus norvegicus


Alignment Length:81 Identity:50/81 - (61%)
Similarity:60/81 - (74%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   610 IQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDK 674
            |.||||||:||.:...:..|.||.:..||||...:||||.||||||||.|||:||||.|||||.|
  Rat    12 ITLWQFLLQLLQEPQNEHVICWTSNNGEFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVK 76

  Fly   675 NIIHKTAGKRYVYRFV 690
            |||.|..|:::||:||
  Rat    77 NIIKKVNGQKFVYKFV 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 50/81 (62%)
Elk4XP_008767689.1 ETS 24..95 CDD:197710 41/69 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.