DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnt and Etv3

DIOPT Version :10

Sequence 1:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001099920.1 Gene:Etv3 / 295297 RGDID:1311577 Length:513 Species:Rattus norvegicus


Alignment Length:85 Identity:51/85 - (60%)
Similarity:63/85 - (74%) Gaps:1/85 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   606 GSGPIQLWQFLLELLLDKTCQSFISW-TGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLR 669
            ||..||||.|:||||..:..:..|:| .|:..||.:.|||||||.||.||.||:|||:||||.||
  Rat    31 GSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALR 95

  Fly   670 YYYDKNIIHKTAGKRYVYRF 689
            |||:|.|:|||.|||:.|:|
  Rat    96 YYYNKRILHKTKGKRFTYKF 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 49/82 (60%)
Etv3NP_001099920.1 ETS 34..120 CDD:197710 49/82 (60%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.