DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnt and ets1

DIOPT Version :9

Sequence 1:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001017558.1 Gene:ets1 / 280651 ZFINID:ZDB-GENE-021115-5 Length:334 Species:Danio rerio


Alignment Length:186 Identity:67/186 - (36%)
Similarity:95/186 - (51%) Gaps:36/186 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LSSLVESKNI-FIKEEPIHG--CKDLCSLSDISDHEASLEVPTALPPLTPGTNRKVNEVLKASFA 167
            :::.|:.|.: .||.|.:..  |.|                   :|.||||:...:::.|.|:|:
Zfish     1 MTAAVDIKPLTIIKSEKVDDLECAD-------------------VPLLTPGSKEMMSQALLATFS 46

  Fly   168 SWEKEVQKCNITKDPREWTEEHVIYWLNWAKNEFSLVSMNLDPFYKMKGRAMVDLGKEKFLAITP 232
            .:.:|.|:.:|.||||||||.||..||.|..|||||.:::...| .|.|.::..||||:||.:.|
Zfish    47 GFTREQQRLSIPKDPREWTEGHVREWLTWTVNEFSLKNVDFHKF-SMDGASLCALGKERFLDLAP 110

  Fly   233 PFTGDILWEHLDILQKDCEKPNEDIVHGNSFESATTASVCGSDHQVANYPNETHAN 288
            .|.|||||.||::|||      ||..|       ...|...|..|.:.||:|...|
Zfish   111 DFVGDILWGHLEMLQK------EDPKH-------FPVSSLSSSFQESRYPSEYFFN 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879 39/70 (56%)
ETS 609..693 CDD:197710
ets1NP_001017558.1 SAM_PNT-ETS-1 43..130 CDD:176092 46/93 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8292
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243757at33208
OrthoFinder 1 1.000 - - FOG0003547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107578
Panther 1 1.100 - - O PTHR11849
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10367
SonicParanoid 1 1.000 - - X2422
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.