DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnt and Erfl

DIOPT Version :10

Sequence 1:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001357733.1 Gene:Erfl / 232974 MGIID:3642958 Length:352 Species:Mus musculus


Alignment Length:84 Identity:54/84 - (64%)
Similarity:63/84 - (75%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   606 GSGPIQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRY 670
            ||..||||.|:||||..:..|..|:|.||..||.:.|||||||.|||||.||.|||:||||.|||
Mouse    38 GSRQIQLWHFILELLQKEEYQGVIAWQGDYGEFVIKDPDEVARLWGIRKCKPHMNYDKLSRALRY 102

  Fly   671 YYDKNIIHKTAGKRYVYRF 689
            ||:|.|:|||.|||:.|:|
Mouse   103 YYNKRILHKTKGKRFTYKF 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 52/81 (64%)
ErflNP_001357733.1 ETS 41..123 CDD:197710 52/81 (64%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.