DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnt and ETV2

DIOPT Version :9

Sequence 1:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:XP_005258709.1 Gene:ETV2 / 2116 HGNCID:3491 Length:370 Species:Homo sapiens


Alignment Length:286 Identity:91/286 - (31%)
Similarity:115/286 - (40%) Gaps:78/286 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 YGGGSNSQ-----NDPTDLSSYGLPAHLAAYGGGS--------GSGPTGGRSSGGGGDESDYHST 492
            :|...:||     .|.||::.....    ::.|.|        |.||.....|.|...::.....
Human   104 WGAEPDSQALPWSGDWTDMACTAWD----SWSGASQTLGPAPLGPGPIPAAGSEGAAGQNCVPVA 164

  Fly   493 ISAQDHQSQQSSGGNGSGGASGGSTGNSNGYLDSSSEFYGSYAGRNRFHDGYPPEFTPYDAQSFQ 557
            ..|......|::|.|.|...|.|..|::         ::||..|..                   
Human   165 GEATSWSRAQAAGSNTSWDCSVGPDGDT---------YWGSGLGGE------------------- 201

  Fly   558 SMGPQPTAMDQWGAAHAHQHPAAYMSTLGLDKGLLGGYTTQ------------------------ 598
               |:......||.      ||....|...:.||..|.||.                        
Human   202 ---PRTDCTISWGG------PAGPDCTTSWNPGLHAGGTTSLKRYQSSALTVCSEPSPQSDRASL 257

  Fly   599 GGVPCFTGSGPIQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEK 663
            ...|.....|||||||||||||.|....|.|.|||:..||:|.||.||||.||.||.||.|||||
Human   258 ARCPKTNHRGPIQLWQFLLELLHDGARSSCIRWTGNSREFQLCDPKEVARLWGERKRKPGMNYEK 322

  Fly   664 LSRGLRYYYDKNIIHKTAGKRYVYRF 689
            |||||||||.::|:.|:.|::|.|||
Human   323 LSRGLRYYYRRDIVRKSGGRKYTYRF 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 54/81 (67%)
ETV2XP_005258709.1 ETS 268..350 CDD:197710 54/81 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.