DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnt and ELK4

DIOPT Version :10

Sequence 1:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001964.2 Gene:ELK4 / 2005 HGNCID:3326 Length:431 Species:Homo sapiens


Alignment Length:81 Identity:49/81 - (60%)
Similarity:59/81 - (72%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   610 IQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDK 674
            |.||||||:||.....:..|.||.:..:|||...:||||.||||||||.|||:||||.|||||.|
Human     5 ITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVK 69

  Fly   675 NIIHKTAGKRYVYRFV 690
            |||.|..|:::||:||
Human    70 NIIKKVNGQKFVYKFV 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 49/81 (60%)
ELK4NP_001964.2 ETS 17..88 CDD:197710 40/69 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..139
PHA03247 <167..350 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..282
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..323
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..431
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.