DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnt and F19F10.1

DIOPT Version :9

Sequence 1:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_504949.2 Gene:F19F10.1 / 184684 WormBaseID:WBGene00017598 Length:210 Species:Caenorhabditis elegans


Alignment Length:123 Identity:42/123 - (34%)
Similarity:63/123 - (51%) Gaps:20/123 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   607 SGPIQLWQFLLELLLDKTCQSFISWTGDGWE--FKLTDPDEVARRWGIRKNKPKMNYEKLSRGLR 669
            :|.::|..||.:||.|::....|.|. |..|  ||::.|.:||..||.....|.|||:|:|||||
 Worm     9 TGKLRLLSFLRDLLEDESNSDIIYWF-DKSESVFKMSKPHKVAELWGAATGNPGMNYDKMSRGLR 72

  Fly   670 YYYDKNIIHKTAGKRYVYRFV-------------CDLQNLVGHTP----EELVAKYDL 710
            |:|..|.:.|..||...|||:             .:|:..|..||    ..|::.:::
 Worm    73 YFYTNNTLEKVPGKDARYRFIDSPRHSFLDFSMKTELETPVKRTPLFNISNLISDFEV 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 36/98 (37%)
F19F10.1NP_504949.2 ETS 11..97 CDD:197710 36/86 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.