DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnt and ets-9

DIOPT Version :9

Sequence 1:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001371009.1 Gene:ets-9 / 180702 WormBaseID:WBGene00016865 Length:225 Species:Caenorhabditis elegans


Alignment Length:213 Identity:58/213 - (27%)
Similarity:87/213 - (40%) Gaps:67/213 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   548 FTPYDAQSFQSMGPQPTAMDQ----WGA-AHAHQHPAAYMSTLGLDKGLLGGYTTQGGVPCFTGS 607
            || :|.:::..:.| ||..:.    |.. :.|.|.|.|                    ||.|..|
 Worm    19 FT-HDVRTYPDISP-PTPTNSHIRCWAQFSIAQQLPCA--------------------VPSFPTS 61

  Fly   608 ---------------------GPIQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWG 651
                                 ||.:|..||:.|.:::..:..:.|||:|.||.|.:.:.||:.||
 Worm    62 LFPLPIMNDEPMTDDELVKMKGPSRLIGFLVHLAMNERARKALRWTGNGLEFVLVNKELVAKMWG 126

  Fly   652 IRKNKPK-MNYEKLSRGLRYYY------DKNIIH---KTAGKRYVYRFV----CDLQNLVGHTPE 702
            .||:..| |:|.||||.:|..|      ||||..   |...:.|.|.|.    .||.|   .|.:
 Worm   127 NRKHNTKDMDYYKLSRAIREKYEKKDKADKNIKPGKLKKGTRTYSYVFTEHAYPDLMN---QTEK 188

  Fly   703 EL--VAKYDLKIEKKDVD 718
            ::  :.::...|.:|..|
 Worm   189 DINFITRFAADIGQKYSD 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 35/97 (36%)
ets-9NP_001371009.1 Ets 86..>150 CDD:413392 26/63 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.