DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnt and Elk4

DIOPT Version :9

Sequence 1:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001363883.1 Gene:Elk4 / 13714 MGIID:102853 Length:430 Species:Mus musculus


Alignment Length:81 Identity:50/81 - (61%)
Similarity:60/81 - (74%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   610 IQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDK 674
            |.||||||:||.:...:..|.||.:..||||...:||||.||||||||.|||:||||.|||||.|
Mouse     5 ITLWQFLLQLLQEPQNEHMICWTSNNGEFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVK 69

  Fly   675 NIIHKTAGKRYVYRFV 690
            |||.|..|:::||:||
Mouse    70 NIIKKVNGQKFVYKFV 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 50/81 (62%)
Elk4NP_001363883.1 ETS 17..88 CDD:197710 41/69 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..138
PHA03247 <170..349 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..279
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.