DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnt and LOC100537796

DIOPT Version :9

Sequence 1:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:XP_009297062.2 Gene:LOC100537796 / 100537796 -ID:- Length:269 Species:Danio rerio


Alignment Length:84 Identity:47/84 - (55%)
Similarity:59/84 - (70%) Gaps:1/84 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   606 GSGPIQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRY 670
            ||..:|||.|||| ||.:.....|:|..:..||.:.||:.:|:.||.||.||.|||:||||.|||
Zfish    35 GSRQVQLWHFLLE-LLGRGEGGAITWGSEWGEFVIRDPERLAKLWGERKGKPHMNYDKLSRALRY 98

  Fly   671 YYDKNIIHKTAGKRYVYRF 689
            ||:|.|:|||.|||:.|||
Zfish    99 YYNKRILHKTKGKRFTYRF 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 45/81 (56%)
LOC100537796XP_009297062.2 ETS 38..122 CDD:197710 45/81 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.