DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and Tnfaip6

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_445834.1 Gene:Tnfaip6 / 84397 RGDID:621359 Length:275 Species:Rattus norvegicus


Alignment Length:297 Identity:59/297 - (19%)
Similarity:90/297 - (30%) Gaps:102/297 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 KNGLPTQSSRWPNGVVPYEIRGNFNARDMATIENAIGEYHR-----RTCIRFVKRSSERDY---- 162
            |||: ..:|.|                    :|.|.|.|||     |..:.:.:..:..:|    
  Rat    21 KNGI-FHNSIW--------------------LEQAAGVYHREARAGRYKLTYAEAKAVCEYEGGR 64

  Fly   163 ------------ISIRGDNSGCWSSVGRVGGKQEVNLQSPGC-LSRPGTAMHELMHALGFLHEQN 214
                        |......:| |.:.||||  ..:....|.| ..:.|...:.:        ..|
  Rat    65 LATYKQLEAARKIGFHVCAAG-WMAKGRVG--YPIVKPGPNCGFGKTGIIDYGI--------RLN 118

  Fly   215 RMER-DGYVAIQYN-NVQ--SSAMNNFEKAARTEAFGVPYD------------YGSVMHYSKNAF 263
            |.|| |.|.   || |.:  .....:.::..::..|...||            ||..:|.|...|
  Rat   119 RSERWDAYC---YNPNAKECGGVFTDPKRIFKSPGFPNEYDDNQVCYWHIRLKYGQRIHLSFLDF 180

  Fly   264 SINGQPTILAMQANGADKMGQRNGF--------------SDYDIQKLNRMYDCGT------VNAV 308
            .:...|..||......|.....:||              |..::..|..:.|...      :..|
  Rat   181 DLEHDPGCLADYVEIYDSYDDVHGFVGRYCGDELPEDIISTGNVMTLKFLSDASVTAGGFQIKYV 245

  Fly   309 PVAPGLPAPAPAPGAPAGSGNPIVDS--FIGGLISGL 343
            .|       .|||.:..|....:..:  |:.|..|.|
  Rat   246 TV-------DPAPKSNQGKNTTMTGNKKFLAGRFSHL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 45/239 (19%)
ZnMc_astacin_like 119..300 CDD:239807 43/232 (19%)
Tnfaip6NP_445834.1 Link_domain_TSG_6_like 36..128 CDD:239592 22/105 (21%)
CUB 135..244 CDD:395345 17/108 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.