DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and Bmp1

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_112613.1 Gene:Bmp1 / 83470 RGDID:620739 Length:990 Species:Rattus norvegicus


Alignment Length:341 Identity:91/341 - (26%)
Similarity:140/341 - (41%) Gaps:97/341 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GIEEIP-PTLGKDIIDLTPLGTALFGKPDEELTANRVGNFSADADEMNPEELGSYLE-------- 94
            |:...| |.|...::.|..|..|  |:|.:      :.:::.|..|.:..||.:|.:        
  Rat     3 GVARPPLPLLSLPLLLLLLLPRA--GRPLD------LADYTYDLGEEDAPELLNYKDPCKAAAFL 59

  Fly    95 GDMLVPQTDL---------IMK-----------------------NGLPTQSSR----------- 116
            ||:.:.:.||         :::                       :|.|.:.||           
  Rat    60 GDIALDEEDLRAFRVQQAAVLRQQTAQRSSIKAAGNSSALGRQSTSGQPQRGSRGRWRSRPRSRR 124

  Fly   117 ---------WPNGVVPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDYISIRGDNSGC 172
                     ||:||:|:.|.|||.....|....|:..:.:.||:.|::|:.|..||.......||
  Rat   125 AATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGC 189

  Fly   173 WSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNF 237
            .|.|||.||..:.......| .:.|..:|||.|.:||.||..|.:||.:|:|...|:|.....||
  Rat   190 CSYVGRRGGGPQAISIGKNC-DKFGIVVHELGHVIGFWHEHTRPDRDRHVSIVRENIQPGQEYNF 253

  Fly   238 EK--AARTEAFGVPYDYGSVMHYSKNAFS-------------ING-QPTILAMQANGADKMGQRN 286
            .|  ....|:.|..||:.|:|||::|.||             :|| :|:|           |||.
  Rat   254 LKMEVQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPSI-----------GQRT 307

  Fly   287 GFSDYDIQKLNRMYDC 302
            ..|..||.:..::|.|
  Rat   308 RLSKGDIAQARKLYKC 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 70/223 (31%)
ZnMc_astacin_like 119..300 CDD:239807 65/196 (33%)
Bmp1NP_112613.1 ZnMc_BMP1_TLD 125..324 CDD:239808 69/211 (33%)
Astacin 132..325 CDD:279708 69/204 (34%)
CUB 326..435 CDD:278839
CUB 439..548 CDD:278839
FXa_inhibition 559..591 CDD:291342
CUB 595..704 CDD:278839
FXa_inhibition 711..746 CDD:291342
CUB 751..860 CDD:278839
CUB 864..977 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.