DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and LOC797085

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001373298.1 Gene:LOC797085 / 797085 -ID:- Length:285 Species:Danio rerio


Alignment Length:227 Identity:78/227 - (34%)
Similarity:115/227 - (50%) Gaps:24/227 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DADEMNPEELGSYLEGDMLVPQTDLIMKNGLPTQSSRWPNG----VVPYEIRGNFNARDMATIEN 140
            |:||      |..||.:.::||||....|.|      ||..    .|||.|......: ...|..
Zfish    77 DSDE------GYALEEEDIIPQTDRNAGNHL------WPEKDGEVSVPYSIASGLEDK-TGHILA 128

  Fly   141 AIGEYHRRTCIRFVKRSSERDYISIRGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMH 205
            |:....::||::|...::|.||:..:.|.. |.|.||..||:|.: |..|.|  ..|...||::|
Zfish   129 ALKMVSKKTCVKFHHHTTEEDYLHFKPDRM-CASLVGCAGGEQPI-LVGPKC--NAGNICHEILH 189

  Fly   206 ALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAARTEAFGVPYDYGSVMHYSKNAFSINGQPT 270
            :||..||.:|.:||.|:.|.|:|:.....:|| |..:....|:.||..|::||..:.||.||..|
Zfish   190 SLGLYHEHSRPDRDKYITILYDNIMPGKESNF-KVKKGNTLGLEYDLDSILHYGDDCFSRNGNHT 253

  Fly   271 ILAMQANGADKMGQRNGFSDYDIQKLNRMYDC 302
            |:. :..|. |:|||...|..|:::|.|:|.|
Zfish   254 IIP-KKKGV-KIGQRTHMSVLDVERLRRLYHC 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 66/191 (35%)
ZnMc_astacin_like 119..300 CDD:239807 62/184 (34%)
LOC797085NP_001373298.1 ZnMc_astacin_like 111..281 CDD:239807 62/177 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.