DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and c6ast1

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001036784.1 Gene:c6ast1 / 751088 ZFINID:ZDB-GENE-070621-1 Length:260 Species:Danio rerio


Alignment Length:262 Identity:96/262 - (36%)
Similarity:135/262 - (51%) Gaps:32/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TLGKDIIDLTPLGTALFGKPDEELTANRVGNFSADADEMNPEELG--SYLEGDMLVPQTDLIMKN 108
            |:.:|||.    .:||..:|         .||:.       |||.  |.:.||:.| .|.|.:..
Zfish    20 TIEQDIIS----ASALMERP---------SNFAG-------EELDEPSIMFGDIAV-GTPLDITA 63

  Fly   109 GLPTQSSRWP---NG--VVPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDYISIRGD 168
            ....||.:||   ||  .|||.|...::.::...|........:.||:||..|:::||||:|. .
Zfish    64 PCTGQSCKWPLSSNGKVFVPYIISDEYSTQEKDVIFQGFRSLEKSTCVRFRPRTTQRDYINIE-P 127

  Fly   169 NSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSA 233
            ||||:|.|||..|.|.|:|...||: :.....|||:|.|||.||.||.:||.:|.|.|.|:....
Zfish   128 NSGCYSFVGRRTGGQTVSLDHDGCI-KLNIVQHELLHTLGFHHEHNRSDRDSHVQIVYKNIIPGQ 191

  Fly   234 MNNFEKAARTEAFGVPYDYGSVMHYSKNAFSINGQPTILAMQANGADKMGQRNGFSDYDIQKLNR 298
            ..||:| .:|......|||.|||||.:.|||.|.:.||:.:..:|. .:|:....|..||.::||
Zfish   192 ERNFDK-IKTNNLETAYDYSSVMHYGRFAFSKNKEATIVPIPDSGV-TIGRAKRMSSNDILRINR 254

  Fly   299 MY 300
            :|
Zfish   255 LY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 76/190 (40%)
ZnMc_astacin_like 119..300 CDD:239807 73/182 (40%)
c6ast1NP_001036784.1 Astacin 71..259 CDD:279708 76/190 (40%)
ZnMc_hatching_enzyme 77..257 CDD:239810 74/184 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 165 1.000 Domainoid score I3861
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 167 1.000 Inparanoid score I4142
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm6586
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.