DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and astl2c

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001037864.1 Gene:astl2c / 594901 XenbaseID:XB-GENE-6449741 Length:496 Species:Xenopus tropicalis


Alignment Length:343 Identity:101/343 - (29%)
Similarity:156/343 - (45%) Gaps:75/343 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLKVFLVLALALSSCQ-------ALPYVSYDDVDDTEVIELPGNGIEEIPPTLGKDIIDLTPLG 58
            ||..:..:|...|..|.       ..|:|..:|.      |:|.|..:                 
 Frog     1 MSSTISFILLFGLFVCATSFPIQIVFPHVEQNDT------EVPDNDDD----------------- 42

  Fly    59 TALFGKPDEELTANR-VGNFSADADEMNPEELGSYLEGDMLVPQTDLIMKNGLPTQSSRWP---N 119
              :||:   .|.||: ..||              :::||:    .....::.:..:...||   |
 Frog    43 --VFGR---ILRANKGKRNF--------------HVQGDI----AHKFSRSAINCKECLWPKDSN 84

  Fly   120 GV--VPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDYISIRGDNSGCWSSVGRVGGK 182
            |:  |||.|..:::..:.:.|..|:.|:...||::|:.::.|.|||:|: ...||||.:|..||.
 Frog    85 GIVNVPYTISSDYSQNEASLIMAAMQEFATLTCVQFIPQTDEDDYIAIQ-PLDGCWSYIGVNGGA 148

  Fly   183 QEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAARTEAFG 247
            |:|:|...||:.. |...|||.|.|||:||.:|.:||.||.|.|..:....:..|:| ..|:..|
 Frog   149 QQVSLGKGGCIYY-GVIQHELNHVLGFVHEHSRSDRDNYVHINYQYISPDNIAFFDK-KDTDNLG 211

  Fly   248 VPYDYGSVMHYSKNAFS-INGQPTILAMQANGADKMGQRNGFSDYDIQKLNRMYDC--------- 302
            :.|||.|||||...::| ..|:.||:.: .|....:|||.|.|..|:.|:||:|.|         
 Frog   212 LEYDYSSVMHYPGYSYSNTTGKNTIVPI-PNANVPIGQRYGLSTLDVSKINRLYQCDVCSKLFTN 275

  Fly   303 --GTVNAVPVAPGLPAPA 318
              |||.:.......|:.|
 Frog   276 ASGTVTSANYPGSYPSNA 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 76/204 (37%)
ZnMc_astacin_like 119..300 CDD:239807 72/183 (39%)
astl2cNP_001037864.1 ZnMc_hatching_enzyme 84..266 CDD:239810 73/185 (39%)
Astacin 89..266 CDD:279708 71/180 (39%)
CUB 270..380 CDD:238001 5/24 (21%)
CUB 383..495 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.