DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and CG34370

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001097404.2 Gene:CG34370 / 5740565 FlyBaseID:FBgn0085399 Length:952 Species:Drosophila melanogaster


Alignment Length:101 Identity:24/101 - (23%)
Similarity:40/101 - (39%) Gaps:27/101 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 ADADEMNPEELGSYLEGDMLVPQTDLIMKNGLPTQSSRW----------------PNG--VVPYE 125
            :.||:||.|.:   ::|...:..   ..||..|...:.:                |:|  |.||:
  Fly   633 SSADQMNLEMI---VQGQHAITS---YFKNPNPLFEATYEFAHGPLCGPITLGPSPDGELVFPYK 691

  Fly   126 IRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERD 161
            ......:..||..|:   .|.|..||..:|.:::||
  Fly   692 KALAMVSGPMAPPEH---HYRREKCIWELKVAAQRD 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 15/64 (23%)
ZnMc_astacin_like 119..300 CDD:239807 14/45 (31%)
CG34370NP_001097404.2 CUB 88..195 CDD:238001
CUB 244..363 CDD:238001
CUB 407..509 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444877
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.