DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and mep1a.2

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001122199.1 Gene:mep1a.2 / 565535 ZFINID:ZDB-GENE-041001-208 Length:689 Species:Danio rerio


Alignment Length:307 Identity:91/307 - (29%)
Similarity:135/307 - (43%) Gaps:66/307 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKVFLVLALALSSCQALPYVSYDDVDDTEVIELPGNGIEEIPPTLGKDIIDLTPLGTALFGKPDE 67
            :.:|.|| |||.:| |||....:|.|..|               |.:||:               
Zfish     7 ISLFFVL-LALKAC-ALPAQYGEDADAGE---------------LREDIL--------------- 39

  Fly    68 ELTANRVGNFSADADEMNPEELGSYLEGDML-VPQTDLIMKNGLPTQSSRW--PNGVVPYEIRGN 129
                           |:|.:......|||:. .|:     :|.:..:.:||  |   :||.:...
Zfish    40 ---------------EINLDSQRELFEGDIAGDPR-----RNAIIDEKARWQFP---IPYILTDT 81

  Fly   130 FNARDMATIENAIGEYHRRTCIRFVKRSSERDYISIRGDNSGCWSSVGRVGGKQEVNLQSPGCLS 194
            .:......|..|:..|..::|:.|.....|..|||.. ...||||.||.:...|.|:: ...|.:
Zfish    82 LDLNAKGVILQALEMYRLKSCVDFKPYEGESTYISFT-KLDGCWSFVGDLKTGQNVSI-GERCDT 144

  Fly   195 RPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAAR---TEAFGVPYDYGSVM 256
            : ....|||:|||||.|||:|.:||.||.|.::.:.....:||.|...   |: ...||||.|:|
Zfish   145 K-AIVEHELLHALGFYHEQSRSDRDDYVKIWWDQIIEGKEHNFNKYEDDFITD-LNTPYDYESIM 207

  Fly   257 HYSKNAFSINGQ-PTILAMQANGADKMGQRNGFSDYDIQKLNRMYDC 302
            ||...:|:.:.. |||........:.:|||..||..|:::|||||:|
Zfish   208 HYRPLSFNKDPDIPTITTTIPAFNNIIGQRLDFSALDLERLNRMYEC 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 68/193 (35%)
ZnMc_astacin_like 119..300 CDD:239807 62/184 (34%)
mep1a.2NP_001122199.1 ZnMc 26..254 CDD:294052 80/284 (28%)
Astacin 68..256 CDD:279708 68/194 (35%)
MAM 259..423 CDD:214533
MAM 264..423 CDD:99706
MATH 423..579 CDD:295307
EGF 619..653 CDD:278437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25214
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.