DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and hce2l1

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_009302797.1 Gene:hce2l1 / 564183 ZFINID:ZDB-GENE-070912-147 Length:232 Species:Danio rerio


Alignment Length:216 Identity:92/216 - (42%)
Similarity:128/216 - (59%) Gaps:13/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 EGDMLVP-QTDLIMKNGLPTQSSRWPNGV-----VPYEIRGNFNARDMATIENAIGEYHRRTCIR 152
            |||:|.| ....|...|   .|.|||..|     |||.:...::..|..|||..:.:....||::
Zfish    21 EGDILSPGSRSAITCLG---DSCRWPKAVDGFVYVPYIMSTLYDDMDRITIETGMLDISSSTCVK 82

  Fly   153 FVKRSSERDYISIRGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRME 217
            ||.|:.:.::::|: ...||||.:|..||.|.|:||||||: ..|.|.|||||||||:|||:|.:
Zfish    83 FVPRTHQANFLNIQ-PRYGCWSYLGMTGGSQTVSLQSPGCM-WSGVASHELMHALGFVHEQSRSD 145

  Fly   218 RDGYVAIQYNNVQSSAMNNFEKAARTEAFGVPYDYGSVMHYSKNAFSINGQPTILAMQANGADKM 282
            ||.||:|.:.|:..:..:||.| ..|......|||.|||||.:.|||.:|.|||:. :.:....:
Zfish   146 RDRYVSILWENIIENQRHNFRK-YETNNLNTAYDYSSVMHYGRYAFSEDGGPTIIP-KPDPYIPI 208

  Fly   283 GQRNGFSDYDIQKLNRMYDCG 303
            |||:|.|..||.|:|.:|:||
Zfish   209 GQRDGPSILDIHKINILYNCG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 84/193 (44%)
ZnMc_astacin_like 119..300 CDD:239807 78/185 (42%)
hce2l1XP_009302797.1 Astacin 41..229 CDD:279708 82/191 (43%)
ZnMc_hatching_enzyme 47..228 CDD:239810 78/184 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 165 1.000 Domainoid score I3861
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 167 1.000 Inparanoid score I4142
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm6586
orthoMCL 1 0.900 - - OOG6_101406
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.