DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and tll2l

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001016661.1 Gene:tll2l / 549415 XenbaseID:XB-GENE-478930 Length:500 Species:Xenopus tropicalis


Alignment Length:242 Identity:87/242 - (35%)
Similarity:135/242 - (55%) Gaps:19/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 EG-DMLVPQTDL---IMKNGLPTQSSRW---PNG--VVPYEIRGNFNARDMATIENAIGEYHRRT 149
            || |.|:.|.|:   ::::.|...:.:|   .||  .||:.:...:....:|.|..|:.|:...|
 Frog    54 EGIDQLLLQGDIAIRVVRSSLQCDNCKWDISSNGKVPVPFTVSPGYTKSQLALITAAMQEFETLT 118

  Fly   150 CIRFVKRSSERDYISIRGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQN 214
            |:.||.:::|::.|:|...| ||||.:||.||.|:|:|....|:.: |...|||.|.|||:||..
 Frog   119 CVDFVPKTNEKNVININNGN-GCWSYIGRSGGVQQVSLSKQSCMVK-GIIQHELNHVLGFVHEHV 181

  Fly   215 RMERDGYVAIQYNNVQSSAMNNFEKAARTEAFGVPYDYGSVMHYSKNAFSINGQPTILAMQANGA 279
            |.:||.||.:...|:...::.||:.|. |...|:||||.|||||.:|||||:.....|..:.:..
 Frog   182 RSDRDQYVNVVKKNILPDSLGNFDIAV-TNNLGLPYDYYSVMHYPRNAFSISPFLPTLITKPDPT 245

  Fly   280 DKMGQRNGFSDYDIQKLNRMYDC-------GTVNAVPVAPGLPAPAP 319
            .::|||.|.::.||.|:|::|:|       ..||....:|..|:..|
 Frog   246 IQIGQRYGLTNLDIAKINKLYNCDVCSTLLSDVNGTLFSPSYPSAYP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 75/199 (38%)
ZnMc_astacin_like 119..300 CDD:239807 72/182 (40%)
tll2lNP_001016661.1 ZnMc_hatching_enzyme 86..268 CDD:239810 73/184 (40%)
CUB 272..382 CDD:238001 5/21 (24%)
CUB 385..495 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.