DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and mep1a

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001015767.1 Gene:mep1a / 548484 XenbaseID:XB-GENE-921661 Length:704 Species:Xenopus tropicalis


Alignment Length:233 Identity:80/233 - (34%)
Similarity:113/233 - (48%) Gaps:14/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GNFSADADEMNPEELGSYLEGDMLVPQTDLIMKNGLPTQSSRWPNGVVPYEIRGNFNARDMATIE 139
            |....|..::|.|...:..|||:::|..   .:|.|.....|| :..:||.:..|.:....:.|.
 Frog    37 GELREDIPQINLESGLNLFEGDIVLPPR---ARNALLDDYYRW-SFPIPYILADNLDLNAKSVIL 97

  Fly   140 NAIGEYHRRTCIRFVKRSSERDYISIRGDNSGCWSSVG--RVGGKQEVNLQSPGCLSRPGTAMHE 202
            .|...:..::|:.|.....|..||..: ...||||.||  :||    .||.............||
 Frog    98 KAFEMFRLKSCVDFKPYEGEPTYIHFQ-KFGGCWSMVGDLKVG----QNLSIGERCDYKAIVEHE 157

  Fly   203 LMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAART--EAFGVPYDYGSVMHYSKNAFSI 265
            ::|||||.|||:|.:||.||.|.:..:.|...:||.|....  .....||||.|||||...:|:.
 Frog   158 ILHALGFYHEQSRSDRDDYVKIWWEEITSGMEHNFNKYEDNYITDLNTPYDYESVMHYGPLSFNK 222

  Fly   266 NGQ-PTILAMQANGADKMGQRNGFSDYDIQKLNRMYDC 302
            |.. |||.|......|.:|||..||:.|:::|||||:|
 Frog   223 NPDVPTITAKIEAFNDIIGQRLDFSEIDLERLNRMYNC 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 70/192 (36%)
ZnMc_astacin_like 119..300 CDD:239807 65/185 (35%)
mep1aNP_001015767.1 ZnMc_meprin 31..260 CDD:239809 79/231 (34%)
MAM 270..431 CDD:366209
MATH_Meprin_Alpha 430..596 CDD:239752
EGF 635..>658 CDD:333761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.