DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and tll1

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001008039.1 Gene:tll1 / 493401 XenbaseID:XB-GENE-479941 Length:495 Species:Xenopus tropicalis


Alignment Length:319 Identity:100/319 - (31%)
Similarity:145/319 - (45%) Gaps:51/319 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLKVFLVLALALSSCQALPYVSYDDVDDTEVIELPGNGIEEIPPTL-GKDIIDLTPLGTALFGK 64
            |...|.|:|...|....               :.||.:|....|.:. |||..|           
 Frog     1 METAVHLILLFCLMGLS---------------LTLPLSGTLPTPKSQDGKDPAD----------- 39

  Fly    65 PDEELTANRVGNFSADADEMNPEELGSYLEGDMLVPQTDLIMKNGLPTQSSRWPNG-----VVPY 124
                      .|...|..:.|.:.....:.||:.: :||   :|.:......||..     .|||
 Frog    40 ----------NNLYTDIMKANQKSKKLRIHGDIAL-KTD---RNAINCTECLWPKSSDGFVYVPY 90

  Fly   125 EIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDYISIRGDNSGCWSSVGRVGGKQEVNLQS 189
            .:..:::..::..|..|:.||...||::|...:.|.||::|: ...||||.:|..||.|.|:|..
 Frog    91 TVSSDYSQDEVNAITTAMKEYEGLTCVQFTPWTGEDDYLAIQ-SLDGCWSYIGYYGGSQAVSLLK 154

  Fly   190 PGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAARTEAFGVPYDYGS 254
            ..| :..|...|||.|||||.||.||.:||.||.|.|..:....:.||:|.: |...||.|||.|
 Frog   155 GFC-AYNGGVQHELNHALGFYHEHNRSDRDDYVTIMYQYISPENIGNFDKIS-TNNLGVDYDYSS 217

  Fly   255 VMHYSKNAFS-INGQPTILAMQANGADKMGQRNGFSDYDIQKLNRMYDCGTVNAVPVAP 312
            ::||:.|||| .:||.||:. ..|....:||..|.|:.|:.|:||:|.|...:.:..||
 Frog   218 ILHYAGNAFSNTSGQNTIVP-HPNPNVPIGQSYGLSNLDVLKINRLYGCDECSTLLSAP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 77/193 (40%)
ZnMc_astacin_like 119..300 CDD:239807 73/186 (39%)
tll1NP_001008039.1 ZnMc_hatching_enzyme 83..265 CDD:239810 74/185 (40%)
CUB 269..379 CDD:238001 2/7 (29%)
CUB 382..494 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.