DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and tll1

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_571085.1 Gene:tll1 / 474335 ZFINID:ZDB-GENE-041020-1 Length:1022 Species:Danio rerio


Alignment Length:403 Identity:113/403 - (28%)
Similarity:162/403 - (40%) Gaps:124/403 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VFLVLA-------LALSSCQALPYVSYDDVDD------TEVIELPGNGIEEIPPTLGKDIIDLTP 56
            :.|:||       :::.||     :.|||..|      ||.|:.             ||     |
Zfish    15 IALLLAGLTFCCKVSVHSC-----LDYDDSYDYYEEEKTETIDY-------------KD-----P 56

  Fly    57 LGTALF----GKPDEEL--------------TANRVGNFSADADEMNP-EELGS-YLEGDMLVPQ 101
            ...|:|    ...||:|              |..|.|:.|....|..| ::.|| ||       .
Zfish    57 CKAAVFWGDIALDDEDLKMFHIDGTIDLKQQTHGRQGHTSGGLGEHVPTKKRGSLYL-------L 114

  Fly   102 TDLIMKNGL---PTQSSR---------------------------------WPNGVVPYEIRGNF 130
            .|.|.:.|.   |..||:                                 ||.||:||.|.|||
Zfish   115 LDRIRRLGFESWPVNSSKDVSSIKTGIRRVNSARNVKSRVPRAATSRAEKIWPGGVIPYVIGGNF 179

  Fly   131 NARDMATIENAIGEYHRRTCIRFVKRSSERDYISIRGDNSGCWSSVGRVG-GKQEVNLQSPGCLS 194
            .....|.::.|:..:.::||:.|::::.|..||.......||.|.|||.| |.|.::: ...| .
Zfish   180 TGSQRAMLKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQAISI-GKNC-D 242

  Fly   195 RPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEK--AARTEAFGVPYDYGSVMH 257
            :.|..:|||.|.:||.||..|.:||.:|.|..:|:|.....||.|  .....:.|.|||:.|:||
Zfish   243 KFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMH 307

  Fly   258 YSKNAFSINGQ--PTIL-AMQANGA-DKMGQRNGFSDYDIQKLNRMYDC-----------GTVNA 307
            |::|.|| .|.  .||| :...||. ..:|||...|..||.:..::|.|           |..: 
Zfish   308 YARNTFS-RGMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRCPACGETLQDSVGNFS- 370

  Fly   308 VPVAPGLPAPAPA 320
               :||.|...|:
Zfish   371 ---SPGYPNGYPS 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 72/238 (30%)
ZnMc_astacin_like 119..300 CDD:239807 68/187 (36%)
tll1NP_571085.1 ZnMc_BMP1_TLD 157..356 CDD:239808 71/201 (35%)
Astacin 164..357 CDD:279708 72/195 (37%)
CUB 358..467 CDD:278839 5/27 (19%)
CUB 471..580 CDD:278839
FXa_inhibition 591..623 CDD:291342
CUB 627..736 CDD:278839
FXa_inhibition 743..778 CDD:291342
CUB 783..892 CDD:278839
CUB 896..1009 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.