DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and tok

DIOPT Version :10

Sequence 1:NP_651138.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_476879.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster


Alignment Length:96 Identity:19/96 - (19%)
Similarity:28/96 - (29%) Gaps:45/96 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 NIPPLGHS--------------RPYYQSTEAAIEQRFNKLRSGGVAAAPVPLPEVVASPLLGSGD 127
            |:.|..:|              |..||.....:|:||     ||   .||....           
  Fly    47 NVDPRDNSALHISIRPREGLIVRNTYQFQSWGVEERF-----GG---CPVQKRS----------- 92

  Fly   128 FGIIKGGTFYYDTDVPGKGFVDEYYGLGYSG 158
                     |:|..:..|   .:.||:..:|
  Fly    93 ---------YFDVSITVK---PDSYGIAVNG 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_651138.1 ZnMc_astacin_like 119..300 CDD:239807 6/40 (15%)
tokNP_476879.1 ZnMc_BMP1_TLD 520..721 CDD:239808
CUB 723..836 CDD:412131
CUB 840..951 CDD:395345
FXa_inhibition 958..993 CDD:464251
CUB 997..1111 CDD:395345
FXa_inhibition 1118..1153 CDD:464251
CUB 1158..1267 CDD:395345
CUB 1271..1390 CDD:238001
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.