DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and MEP1B

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_005916.2 Gene:MEP1B / 4225 HGNCID:7020 Length:701 Species:Homo sapiens


Alignment Length:235 Identity:93/235 - (39%)
Similarity:135/235 - (57%) Gaps:13/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GNFSADADEMNPEELG-SYLEGDMLVPQTDLIMKNGLPTQSSRWPNGVVPYEIRGNFNARDMATI 138
            |....|..::| |.|| ...|||:.:.:..:  :|.:..:..|||: .:||.:..:........|
Human    31 GGMDQDIFDIN-EGLGLDLFEGDIRLDRAQI--RNSIIGEKYRWPH-TIPYVLEDSLEMNAKGVI 91

  Fly   139 ENAIGEYHRRTCIRFVKRSSERDYISI-RGDNSGCWSSVG-RVGGKQEVNLQSPGCLSRPGTAMH 201
            .||...|..:|||.|...:.|.:|||: :|  |||||||| |..||||::: ...| .|..|..|
Human    92 LNAFERYRLKTCIDFKPWAGETNYISVFKG--SGCWSSVGNRRVGKQELSI-GANC-DRIATVQH 152

  Fly   202 ELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAAR--TEAFGVPYDYGSVMHYSKNAFS 264
            |.:|||||.|||:|.:||.||.|.::.:.|...:||...:.  :::..|||||.|||||||.||.
Human   153 EFLHALGFWHEQSRSDRDDYVRIMWDRILSGREHNFNTYSDDISDSLNVPYDYTSVMHYSKTAFQ 217

  Fly   265 INGQPTILAMQANGADKMGQRNGFSDYDIQKLNRMYDCGT 304
            ...:|||:...::..|.:|||..|||.|:.|||::|:|.:
Human   218 NGTEPTIVTRISDFEDVIGQRMDFSDSDLLKLNQLYNCSS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 83/191 (43%)
ZnMc_astacin_like 119..300 CDD:239807 78/184 (42%)
MEP1BNP_005916.2 ZnMc_meprin 26..255 CDD:239809 92/231 (40%)
Astacin 69..257 CDD:279708 83/192 (43%)
MAM 260..427 CDD:214533
MAM 265..427 CDD:99706
MATH 427..586 CDD:295307
Required for proteolytic processing 595..607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4542
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8634
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.