DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and CG6974

DIOPT Version :10

Sequence 1:NP_651138.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster


Alignment Length:212 Identity:74/212 - (34%)
Similarity:112/212 - (52%) Gaps:11/212 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 QTDLIMKNGLPTQSSRWPNGVVPYEIRGNFNARDMATIENAIGEYHRRTCIRFVK----RSSERD 161
            |.:...:|.|.:...|||...:.|.|..:::.:::|.:..|:..:..:||::|.:    ..:.:.
  Fly    41 QAEAKTRNALTSPLQRWPGNKILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKR 105

  Fly   162 YISIRGDNSGCWSSVGRVG---GKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVA 223
            |:|.:...:.|.:.||...   |..||.|... ||:.|....||.:|.||..|||:|.:||.||.
  Fly   106 YVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEK-CLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQ 169

  Fly   224 IQYNNVQSSAMNNFEKAARTEAFGVPYDYGSVMHYSKNAFSIN-GQPTILAMQANGA--DKMGQR 285
            |.|:|:.....:.|....:|..|.|||||.||||||||||:.: .:|||.|:....|  .:|||.
  Fly   170 IDYDNIPRKYWSQFMAMDQTTTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQV 234

  Fly   286 NGFSDYDIQKLNRMYDC 302
            .|.|:.|..|:..||.|
  Fly   235 RGPSEGDWTKIRLMYKC 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_651138.1 ZnMc_astacin_like 119..300 CDD:239807 65/190 (34%)
CG6974NP_650414.1 ZnMc_astacin_like 59..249 CDD:239807 65/190 (34%)

Return to query results.
Submit another query.