DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and CG10280

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001246942.1 Gene:CG10280 / 40740 FlyBaseID:FBgn0037395 Length:362 Species:Drosophila melanogaster


Alignment Length:329 Identity:103/329 - (31%)
Similarity:157/329 - (47%) Gaps:55/329 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLKVFLVLALALSSCQALPYVSYDDVDDTEVIELPGNGIEEIPPTLGKDIID---------LTP 56
            :.:.|.||..|.||:...           :|..:||   :.:.|  .|.|..:         |.|
  Fly    44 LQVAVLLVALLVLSATTL-----------SESAKLP---VRQYP--AGVDFFEHEFTSVAEVLKP 92

  Fly    57 LGTAL--FGKPDEELTANRVGNFSADADEMNPEELGSYLEGDMLV-PQTDLIMKNGL-PTQSSR- 116
            |....  :| ||       :|:.....|:  ||.:....:||:.: |.|.:.::.|: |.:..: 
  Fly    93 LSDEYDPYG-PD-------IGDDDLGIDD--PETMPRLFQGDIAIDPYTYITLRLGVNPMRHPKR 147

  Fly   117 -WPNGVVPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSE-RDYISIR---GDNSGCWSSV 176
             ||||.:|:||...:..::...|..|:..::..||:.||....| .||:.|.   ....||||.|
  Fly   148 LWPNGTIPFEISPRYANQERQAIIQAVKTFNSLTCVHFVPYDGEVDDYLLIEPPLEGPQGCWSYV 212

  Fly   177 GRVGGKQEVNLQSPG-----CLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNN 236
            ||.||:|.|:||.|.     |.|..|..|||||||:|..|||:|.:||.:|.|.::|:......|
  Fly   213 GRRGGEQVVSLQRPDENSAHCFSSEGRIMHELMHAIGIYHEQSRADRDNFVKIHWDNIVPRFRKN 277

  Fly   237 FEKAARTEA-FGVPYDYGSVMHYSKNAFS--INGQPTILAMQANGADKMGQRNGFSDYDIQKLNR 298
            |:..::.:. :...|||.|||||.:..||  ...:||:..:|.  ..::|||...|..|..|:|.
  Fly   278 FKLVSKKKGKYAFDYDYNSVMHYGEFYFSKRKGEKPTMTPLQP--GVRIGQRKTISKIDCLKINE 340

  Fly   299 MYDC 302
            :|.|
  Fly   341 LYGC 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 75/201 (37%)
ZnMc_astacin_like 119..300 CDD:239807 71/192 (37%)
CG10280NP_001246942.1 Astacin 147..344 CDD:279708 74/198 (37%)
ZnMc_astacin_like 151..342 CDD:239807 71/192 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444912
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
Isobase 1 0.950 - 0 Normalized mean entropy S5777
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115954at6960
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.