DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and npsn

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_991319.2 Gene:npsn / 404039 ZFINID:ZDB-GENE-040420-2 Length:280 Species:Danio rerio


Alignment Length:260 Identity:95/260 - (36%)
Similarity:140/260 - (53%) Gaps:29/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EELTANRVGNFSADADEMNPEELGSYLE----------------GDMLVPQ----TDLIMKNGLP 111
            |:::....|||:...:.:    :.|.:|                ||:..|:    .|.....|..
Zfish    27 EKMSKKTGGNFTKKGNLL----VSSVIETSKHAGENTDGPVILFGDIAFPRGLQNADQCTARGCK 87

  Fly   112 TQSSRWPNGVVPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDYISIRGDNSGCWSSV 176
            ...||.....|||:|...::.|::|.||..:..:...:|||||..:.||:|::|:.: |||:|.:
Zfish    88 WDRSRDGLVYVPYQISRAYSPREVAVIEQGLQSFSAVSCIRFVPHTGERNYLNIKSE-SGCYSYL 151

  Fly   177 GRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAA 241
            ||:||.|.|:||..||:.. .|..|||:|||||.|||||.:||.::.|.|.|:..:...||.| .
Zfish   152 GRIGGGQVVSLQRQGCVYF-STVQHELLHALGFHHEQNRSDRDNHIRILYQNIIPAQQYNFNK-Q 214

  Fly   242 RTEAFGVPYDYGSVMHYSKNAFSINGQPTILAMQANGADKMGQRNGFSDYDIQKLNRMYDCGTVN 306
            .|...|.||||.|||.||:.|||:|.|||::.: .|....:|:....|..||.::||:| |.|.|
Zfish   215 NTNNLGTPYDYNSVMQYSRYAFSMNNQPTMVPV-PNANVVLGEAQSMSPNDILRINRLY-CSTFN 277

  Fly   307  306
            Zfish   278  277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 81/187 (43%)
ZnMc_astacin_like 119..300 CDD:239807 78/180 (43%)
npsnNP_991319.2 Astacin 87..275 CDD:279708 82/192 (43%)
ZnMc_hatching_enzyme 93..273 CDD:239810 79/184 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 165 1.000 Domainoid score I3861
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 167 1.000 Inparanoid score I4142
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm6586
orthoMCL 1 0.900 - - OOG6_101406
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.