Sequence 1: | NP_001262871.1 | Gene: | CG6763 / 42754 | FlyBaseID: | FBgn0039069 | Length: | 354 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001360030.1 | Gene: | nas-39 / 3565986 | WormBaseID: | WBGene00003555 | Length: | 928 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 71/199 - (35%) |
---|---|---|---|
Similarity: | 107/199 - (53%) | Gaps: | 12/199 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 117 WPNGVVPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRS-SERDYISIRGDNSGCWSSVGRVG 180
Fly 181 -GKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKA--AR 242
Fly 243 TEAFGVPYDYGSVMHYSKNAFSING-QPTILAMQANGAD-KMGQRNGFSDYDIQKLNRMYDC--- 302
Fly 303 -GTV 305 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6763 | NP_001262871.1 | Astacin | 116..304 | CDD:279708 | 69/196 (35%) |
ZnMc_astacin_like | 119..300 | CDD:239807 | 65/186 (35%) | ||
nas-39 | NP_001360030.1 | ZnMc_BMP1_TLD | 48..247 | CDD:239808 | 68/191 (36%) |
CUB | 268..343 | CDD:214483 | |||
CUB | 359..474 | CDD:238001 | |||
FXa_inhibition | 480..515 | CDD:373209 | |||
CUB | 519..622 | CDD:366096 | |||
FXa_inhibition | 629..664 | CDD:373209 | |||
CUB | 669..780 | CDD:238001 | |||
CUB | 782..898 | CDD:238001 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |