DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and CG11865

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster


Alignment Length:248 Identity:89/248 - (35%)
Similarity:138/248 - (55%) Gaps:24/248 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LGTALFGKPDEELTANRVGNFSADADEMNPEELGSYLEGDMLVPQTDLIMKNGLPTQSSRWPNGV 121
            ||::..|:|..:|..:.:...|        |:| .|.||::    ...::|:   .....|....
  Fly    12 LGSSANGRPSIKLQEDDIILIS--------EQL-QYFEGNL----EGRVVKS---WSEYYWKGRT 60

  Fly   122 VPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERD-YISIRGDNSGCWSSVGRVG-GKQE 184
            :.|...|.|::.|:|:||:|:.|...:||::|.:...:|: .:.|:.:.|||||.||.:| ..|.
  Fly    61 LVYSYAGGFSSLDIASIESAMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRADQT 125

  Fly   185 VNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFE--KAARTEAFG 247
            :||.| ||:|. .|..|||:|||||.|..:..:||.||.||.:|::|...:||:  :|.....:|
  Fly   126 LNLGS-GCMSN-RTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANGVTNYG 188

  Fly   248 VPYDYGSVMHYSKNAFSINGQPTILAMQANGADKMGQRNGFSDYDIQKLNRMY 300
            ..|||.|:|||...|||.|||.||:.::::.  |:||....|..|:|.|.|||
  Fly   189 FGYDYDSIMHYGPFAFSKNGQSTIVPLKSHA--KIGQATQMSPKDVQTLKRMY 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 77/189 (41%)
ZnMc_astacin_like 119..300 CDD:239807 74/184 (40%)
CG11865NP_609759.1 Astacin 56..239 CDD:279708 75/186 (40%)
ZnMc_astacin_like 58..239 CDD:239807 74/184 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444832
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115954at6960
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.