DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and Semp1

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster


Alignment Length:230 Identity:86/230 - (37%)
Similarity:119/230 - (51%) Gaps:17/230 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NPEELGSYLEGDMLVPQTDLIMKNGLPTQSSRWPNGVVPYEIRGN-FNARDMATIENAIGEYHRR 148
            :||.|..:.:||  :....:..:||:..|...|||..|||.|..: |.......|..||......
  Fly    23 DPELLAGFYQGD--IKAHPIRTRNGIVNQIYHWPNRTVPYMIEDDAFADSHYREILRAISIIEEN 85

  Fly   149 TCIRFVKRSSERDY---ISIRGDNSGCWS-SVGRVGGKQEVNLQ----SPGCLSRPGTAMHELMH 205
            :|:.| |.::|.|:   :.|.....||.: .:|.....|.|||:    ..||. |.|:.:|||:|
  Fly    86 SCVIF-KPATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCF-RIGSIIHELLH 148

  Fly   206 ALGFLHEQNRMERDGYVAIQYNNVQSSAMNNF---EKAARTEAFGVPYDYGSVMHYSKNAFSING 267
            .|||.|:.....||.||:||:.|:......||   :.:.....|...|||.|||||...|||.||
  Fly   149 VLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNG 213

  Fly   268 QPTILAMQANGADKMGQRNGFSDYDIQKLNRMYDC 302
            ||||:.:: .||:.||||...|:.||:|||:||.|
  Fly   214 QPTIVPLR-EGAENMGQRFYMSEKDIRKLNKMYRC 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 78/199 (39%)
ZnMc_astacin_like 119..300 CDD:239807 73/192 (38%)
Semp1NP_609756.1 Astacin 53..249 CDD:279708 78/198 (39%)
ZnMc_astacin_like 55..245 CDD:239807 73/192 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444833
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5777
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115954at6960
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.