DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and nas-21

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_505907.2 Gene:nas-21 / 188422 WormBaseID:WBGene00003540 Length:380 Species:Caenorhabditis elegans


Alignment Length:198 Identity:62/198 - (31%)
Similarity:96/198 - (48%) Gaps:30/198 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 RWPNGVVPY---EIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDYISIR-GDNSGCWSSV 176
            |||.|.:.|   |.|.:.|:|  ||:..|:.:....|||:|..:.:.   |.:| ..:.||.:::
 Worm    55 RWPRGTINYFFDEQRFDENSR--ATVLRAMEKISNHTCIKFSPKDAR---IKLRIVSDKGCQAAI 114

  Fly   177 GRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAA 241
            |||||.|:. |..|......|:| .||:|.:||||...|.:||.|:.:   |:|...:|::.:..
 Worm   115 GRVGGDQQY-LSFPTSCYSVGSA-SELIHVIGFLHSHQRADRDEYLKL---NLQPWRLNDWFQTM 174

  Fly   242 RTEAF-----GVPYDYGSVMHY--SKNAFSINGQPTILAMQANGADKMGQRNGFSDYDIQKLNRM 299
            :.:.:     .|||||||:|.|  |.|.:..........|.:       |...:.||  ..:|..
 Worm   175 QYKKYLDQWWIVPYDYGSIMQYHDSDNEYGPKNSKYFRTMGS-------QIPSYFDY--LMINEY 230

  Fly   300 YDC 302
            |.|
 Worm   231 YQC 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 62/198 (31%)
ZnMc_astacin_like 119..300 CDD:239807 57/191 (30%)
nas-21NP_505907.2 ZnMc 52..192 CDD:214576 49/146 (34%)
ZnMc_astacin_like 59..231 CDD:239807 57/190 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.