DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and nas-20

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_505906.2 Gene:nas-20 / 188420 WormBaseID:WBGene00003539 Length:379 Species:Caenorhabditis elegans


Alignment Length:267 Identity:78/267 - (29%)
Similarity:107/267 - (40%) Gaps:75/267 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 SRWPNGV-------VPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDYISIRGDNSGC 172
            ::|.|..       :|.|::..|  ||      ||......||::|....:....:.||..| ||
 Worm    36 AKWENNKMSLFFYNLPLEMQAMF--RD------AINYLENHTCLKFEYNENAETAVRIRKGN-GC 91

  Fly   173 WSSVGRVGGK-QEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNN 236
            :|..|...|: |::.|.. .|.|. |||:||:|||||..|.|.|.:||.|:.:...| .:..:.|
 Worm    92 YSLYGMHAGEVQDLTLDY-NCASF-GTAVHEIMHALGIAHGQARSDRDDYLIVDSTN-SNDGIEN 153

  Fly   237 FEKAARTEAFGVPYDYGSVMHYSKNAFSINGQPTILAMQANGADK-----------MGQ-RNGFS 289
            .|..       ||:||||||.|:::..|               ||           ||. |..| 
 Worm   154 TENL-------VPFDYGSVMLYARDPHS---------------DKRIPIDPEYNFTMGSLRVAF- 195

  Fly   290 DYDIQKLNRMYDCGTVNAVPVAPGLPAPAPAPGAPAGSGNP-------IVDSFIGGLI---SGLG 344
             ||:..||:.|.|...|         .|........|..||       ..|.|.|.|.   .|:.
 Worm   196 -YDMVLLNKFYGCNCDN---------HPRKLDCKNGGYQNPANCEECLCTDGFNGQLCDQHEGVY 250

  Fly   345 LGDEKKE 351
            :.:.|||
 Worm   251 VLEAKKE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 65/207 (31%)
ZnMc_astacin_like 119..300 CDD:239807 62/200 (31%)
nas-20NP_505906.2 Astacin 36..209 CDD:279708 65/208 (31%)
ZnMc 49..205 CDD:294052 61/191 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.