DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and nas-33

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_509086.2 Gene:nas-33 / 186987 WormBaseID:WBGene00003551 Length:644 Species:Caenorhabditis elegans


Alignment Length:291 Identity:90/291 - (30%)
Similarity:130/291 - (44%) Gaps:45/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IIDLTPLGTALFGKPDEELTA---------NRVGNFSADADEMNPEELGSY-------------- 92
            :::.....||.|.:|.|....         ||......|.:.:.|.. |.|              
 Worm   106 VVNSVNQNTAAFQRPGESYDKVIQIMSSYFNRKSGSQYDINTVIPSS-GIYNNEMAANSKIAAVM 169

  Fly    93 LEGDM--LVPQTDLIMKNGLPTQSSRWPNGV-----VPY---EIRGNFNARDMATIENAIGEYHR 147
            .|.||  .|.|.:.:.:||...:.....||.     :||   :..||:.::    |.|.:..|.|
 Worm   170 FESDMALTVSQMNKVAQNGFRVKRKMNLNGTTWSRNIPYRFLDTDGNWQSQ----ITNGLRHYER 230

  Fly   148 RTCIRFVKRSSERDYISIRGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHE 212
            .|||||.......||: :.....||:|||||:||.||::: ..|| ...|...||:.|||||.||
 Worm   231 NTCIRFSLNGGGSDYL-VFSKGEGCYSSVGRLGGPQEISI-GDGC-ETLGIITHEVGHALGFWHE 292

  Fly   213 QNRMERDGYVAIQYNNVQSSAMNNFEKAARTEA--FGVPYDYGSVMHYSKNAFSING-QPTILAM 274
            |.|.|||.||.|...|..:.....|:|.:.:|.  :.:||||||||||...:||.:. ..|:..:
 Worm   293 QARPERDSYVRINRQNAINGLEGQFDKRSWSEVNEYSLPYDYGSVMHYGPKSFSKSSTMNTVEPV 357

  Fly   275 QANGADKMGQRNGFSDYDIQKLNRMYDCGTV 305
            .....:.:|.|...|..|::.||..: |..:
 Worm   358 DPAFINTIGNRVEPSFLDLKLLNTAF-CSNI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 72/198 (36%)
ZnMc_astacin_like 119..300 CDD:239807 71/191 (37%)
nas-33NP_509086.2 Astacin 200..386 CDD:279708 70/193 (36%)
ZnMc_astacin_like 203..381 CDD:239807 68/184 (37%)
CUB 442..527 CDD:294042
TSP1 553..595 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.