DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and nas-18

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001309451.1 Gene:nas-18 / 186924 WormBaseID:WBGene00003537 Length:240 Species:Caenorhabditis elegans


Alignment Length:200 Identity:60/200 - (30%)
Similarity:92/200 - (46%) Gaps:22/200 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 RTCIRFVKRSSERDYISIRGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHE 212
            :||:.|.:..|..:.:.: .:..||.|.:|.....|.:..... |:.. |||:||||||||.:|.
 Worm    11 QTCVTFEENCSIPNRVQL-VNGKGCSSYIGMNNIVQHLTFNDT-CIDF-GTAVHELMHALGVIHT 72

  Fly   213 QNRMERDGYVAIQYNNVQSSAMNN---FEKAARTEAFGVPYDYGSVMHYSKNAFSINGQPTILAM 274
            .:|::||.::.|...||....|:|   |.::...    |||:|||.|||..|.      .|:...
 Worm    73 HSRLDRDNFLNINLTNVSKEMMHNYAIFNQSTNV----VPYEYGSTMHYYANI------STMFPK 127

  Fly   275 QANGADKMG-QRNGFSDYDIQKLNRMYDCGTVNAVPVAPG---LPAPAPAPGAPAGSGNPIVDSF 335
            ::..:..:| .|..|  ||:..||..|:|...|.:....|   .|:.......|.|.|..:.|..
 Worm   128 KSEYSATLGIGRVTF--YDMVILNTAYNCKCPNELLCGNGGYTNPSKCSECICPLGYGGVLCDRP 190

  Fly   336 IGGLI 340
            |.|.:
 Worm   191 ITGSV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 51/159 (32%)
ZnMc_astacin_like 119..300 CDD:239807 49/155 (32%)
nas-18NP_001309451.1 ZnMc 5..152 CDD:294052 49/155 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.