DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and nas-31

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001023994.1 Gene:nas-31 / 186493 WormBaseID:WBGene00003549 Length:611 Species:Caenorhabditis elegans


Alignment Length:257 Identity:85/257 - (33%)
Similarity:123/257 - (47%) Gaps:34/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SSRWPNGVVPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRSSERDYISI-RGDNSGCWSSVG 177
            |:.|.:.|..|..| ....:.:...|.|:..:...|||..::.|:..:.|.: :|  .||:|.||
 Worm   168 STTWGSSVYYYYDR-TATPKIVKAFEQAVAFWQNVTCINIMQSSTAINRIRVFKG--QGCYSYVG 229

  Fly   178 RVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAAR 242
            |:.|.|:::| ..|| ...|||.|||.|||||.|.|:|.:||.|::|.|.|:..|.:..|:|...
 Worm   230 RISGVQDLSL-GTGC-EEFGTAAHELGHALGFFHTQSRYDRDNYISINYANIDPSYVEQFDKETS 292

  Fly   243 TEAF--GVPYDYGSVMHYSKNAFSINGQPTILAMQANGADKMGQRNGFSD----YDIQKLNRMYD 301
            ...|  |:||||||:|.|...:.|.|.:.|::|......|.||     ||    |||..:|..|.
 Worm   293 NTNFNYGMPYDYGSIMQYGATSASSNDKATMIARDTEYQDTMG-----SDFVGFYDISMMNEHYK 352

  Fly   302 CGTVNAVPVAPGLPAPAPAPGAPAGSGNP------IVDSFIGGLISGL---GLGDEKKETSS 354
            |..:        .||.:.|.....|..:|      |..|..||::...   |.||....|::
 Worm   353 CKEL--------CPAASSAQCKNGGFPSPRNCAICICPSGYGGILCDQRPPGCGDSVTATTT 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 71/194 (37%)
ZnMc_astacin_like 119..300 CDD:239807 68/187 (36%)
nas-31NP_001023994.1 Astacin 169..355 CDD:279708 71/195 (36%)
ZnMc_astacin_like 175..351 CDD:239807 68/185 (37%)
ShKT 532..564 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.