DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6763 and nas-1

DIOPT Version :9

Sequence 1:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_499768.2 Gene:nas-1 / 185811 WormBaseID:WBGene00003520 Length:270 Species:Caenorhabditis elegans


Alignment Length:212 Identity:82/212 - (38%)
Similarity:122/212 - (57%) Gaps:8/212 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 DMLVPQTDLIMKNG--LPTQSSRWPNGVVPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKRS- 157
            ||.:|........|  :..:..:||||.|||.:...:.:...|.:..|...|.:|||||||.:| 
 Worm    57 DMRIPFQRFKRGGGVAVAAEKDKWPNGRVPYILSAAYTSAQRAVLARAFDTYAKRTCIRFVPKSP 121

  Fly   158 SERDYISIRGDNSGCWSSVGRVGGKQEVNLQSPGCLSRPGTAMHELMHALGFLHEQNRMERDGYV 222
            :::|||.|: ...||::...||||:|:|:| :..|:.. .|.:|||||.:||:||..|.:||.||
 Worm   122 ADKDYIVIQ-KLDGCYADFSRVGGRQQVSL-ADECIDY-ATIIHELMHVIGFIHEHQREDRDSYV 183

  Fly   223 AIQYNNVQSSAMNNFEKAAR--TEAFGVPYDYGSVMHYSKNAFSINGQPTILAMQANGADKMGQR 285
            :|.|.||...|..:|:|.:.  ...:|..|||.|:|||..|..|.||:.||.|..::....||:.
 Worm   184 SILYQNVIQGANTDFDKLSNLGLSYYGEHYDYSSIMHYEANEGSRNGKNTIEAKNSHFTAIMGKA 248

  Fly   286 NGFSDYDIQKLNRMYDC 302
            :.||..|::::||.|.|
 Worm   249 SDFSTSDLRRVNRAYKC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 78/190 (41%)
ZnMc_astacin_like 119..300 CDD:239807 74/183 (40%)
nas-1NP_499768.2 Astacin 79..266 CDD:279708 78/190 (41%)
ZnMc_astacin_like 82..263 CDD:239807 74/183 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.